You have no items in your shopping cart.
Description
Images & Validation
−
Key Properties
−| Target | Neurokinin Receptor |
|---|---|
| CAS Number | 150138-78-6 |
| MW | 4011.48 |
| Purity | ≥95% |
| Formula | C175H269N53O54S |
| Protein Sequence | SKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 |
Storage & Handling
−| Expiration Date | 6 months from date of receipt. |
|---|---|
| Disclaimer | For research use only |
Similar Products
−Peptide YY (PYY) (3-36), human [orb1296771]
97.76% (May vary between batches)
3980.42
1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg, 500 mgPeptide YY (PYY) (3-36), human acetate [orb3180294]
99.79% (May vary between batches)
10 mg, 1 mg, 100 mg, 5 mg, 25 mg, 50 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
Gene Symbol
Neurokinin Receptor
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide