NAPA Rabbit Polyclonal Antibody

SKU: orb592799

Description

NAPA Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of NAPA. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human NAPA. This antibody is predicted to react with Bovine, Canine, Mouse, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

• Tested Applications: WB
• Predicted Reactivity: Bovine, Canine, Mouse, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NAPA
• Target: NAPA
• Protein Sequence: Synthetic peptide located within the following region: MDNSGKEAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAAN
• Molecular Weight: 33kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

SNAPA

Quick Database Links

Gene Symbol

NAPA

UniProt

P54920

RefSeq (Protein):NP_003818