You have no items in your shopping cart.
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia Coli |
|---|---|
| Biological Activity | The ED50 as determined by inhibiting BMP-4-induced alkaline phosphatase production of murine ATDC5 cells is less than 2ng/ml, corresponding to a specific activity of > 5.0 × 105 IU/mg in the presence of 5ng/ml BMP-4. |
| Purity | Greater than 95.0% as determined by SDS-PAGE. |
| Protein Sequence | MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGQRCGWIPIQYPIISECKCSC |
Storage & Handling
−| Storage | Stability: Lyophilized Mouse Noggin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Mouse Noggin should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Buffer/Preservatives | Lyophilized from a 0.2μm filtered solution in 30% acetonitrile, 0.1% TFA. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant Mouse NOG/Noggin Protein, C-Fc [orb2965007]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
52.17 kDa
1 mg, 50 μg, 100 μgRecombinant Mouse Noggin Protein [orb3002448]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE. (QC verified). SEC-HPLC: Greater than 95% as determined by SEC-HPLC. (Regularly tested)
Predicted: 23.9 KDa. Observed: 30 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinantNoggin,Mouse(CHO-expressed) [orb1494673]
> 95% as analyzed by SDS-PAGE.
29-31 kDa, observed by reducing SDS-PAGE.
CHO
5 μg, 25 μgMouse Noggin protein [orb707259]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
10 μg, 50 μg, 500 μgRecombinant mouse Noggin protein (Active,CHO) [orb2328301]
≥ 95% as determined by SDS-PAGE.
29-31 kDa
10 μg, 50 μg, 500 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.