You have no items in your shopping cart.
Featured
Active
Description
Research Area
Cell Biology
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | Fully biologically active when compared to standard. The ED50 as determined by its ability to induce alkaline phosphatase production by murine MC3T3E1 cells is 520 μg/ml. |
| Tag | Tag-Free |
| Expression Region | 24-198aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 20.0 kDa |
| Purity | > 98% as determined by SDSPAGE and HPLC. |
| Protein Sequence | IIGPGRGPVGRRRYVRKQLVPLLYKQFVPSMPERTLGASGPAEGRVTRGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHIHVSVKADNSLAVRAGG |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered PBS, pH 7.4,1 mM DTT, 0.05 % Tween-80 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−DHH,
Similar Products
−RecombinantShh,Mouse(CHO-expressed) [orb1494667]
> 95% as analyzed by SDS-PAGE and HPLC.
20 kDa, observed by non-reducing SDS-PAGE.
CHO
1 mg, 10 μg, 50 μgRecombinantDHH,Mouse [orb1494897]
> 98% as analyzed by SDS-PAGE and HPLC.
20.1 kDa, observed by reducing SDS-PAGE.
Escherichia coli.
1 mg, 10 μg, 50 μgRecombinantIHH,Human [orb1494835]
> 95% as analyzed by SDS-PAGE.
20 kDa, observed by reducing SDS-PAGE.
Escherichia coli.
1 mg, 50 μg, 10 μgMouse Desert hedgehog (Dhh) (Active) Recombinant Protein [orb1650732]
>98% as determined by SDS-PAGE and HPLC.
20.0 kDa
250 μg, 1 mg, 500 μg, 100 μg, 25 μg, 5 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide

