Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

mCRAMP (mouse)

SKU: orb1147088

Description

Sole murine cathelicidin and homologue of human LL 37; Antibacterial; Antiviral; Antimicrobial peptides.

Research Area

Infectious Disease & Virology

Images & Validation

Key Properties

MW3878.7 Da
Purity> 95% by HPLC
FormulaC178H302N50O46
Protein SequenceH-Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln-OH

Storage & Handling

StorageStore dry, frozen and desiccated
Form/AppearanceFreeze dried solid
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Mouse calethicidin related antimicrobial peptide, antimicrobial activityAM040, GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ, H-GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ-OH, mCRAMP (mouse) or mouse cathelicidin-related antimicrobial peptide, murine cathelicidin

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

1 mg
$ 330.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry