Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Description

Disrupts TGF-β/TβR2 interaction; Peptides.

Images & Validation

−

Key Properties

−
MW3228.48 Da
Purity> 95% by HPLC
FormulaC149H203N39O43
Protein SequenceH-Phe-Gln-Gly-Thr-Phe-Pro-Asp-Gly-Phe-Leu-Trp-Ala-Val-Gly-Ser-Ala-Ala-Tyr-Gln-Thr-Glu-Gly-Gly-Trp-Gln-Gln-His-Gly-Lys-Gly-OH

Storage & Handling

−
StorageStore dry, frozen and in the dark
Form/AppearanceFreeze dried solid
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

−
FQGTFPDGFLWAVGSAAYQTEGGWQQHGKG, KP-1,, KP1, KP1 (human), Klotho-derived peptide 1PP290

Similar Products

−
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

1 mg
$ 410.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry