KIR2DL1 Peptide - C-terminal region

SKU: orb2010179

Description

KIR2DL1 Peptide - C-terminal region, also known as CD158A, KIR-K64, KIR221, NKAT, NKAT1, p58.1, is a synthetic peptide designed for use in combination with KIR2DL1 Rabbit Polyclonal Antibody (orb585653). It corresponds to the sequence DEQDPQEVTYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAESRS and is supplied in a lyophilized powder. This peptide is for research use only.

Research Area

Immunology & Inflammation

Images & Validation

• Tested Applications: IP, WB
• Application Notes:
  This is a synthetic peptide designed for use in combination with KIR2DL1 Rabbit Polyclonal Antibody (orb585653). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Key Properties

• Protein Sequence: DEQDPQEVTYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAESRS

Storage & Handling

• Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized powder
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CD158A, KIR-K64, KIR221, NKAT, NKAT1, p58.1

Quick Database Links

UniProt

P43626

RefSeq (Protein):NP_055033