Human RUVBL2 protein

SKU: orb383108

Description

This Human RUVBL2 protein spans the amino acid sequence from region 2-463aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Epigenetics & Chromatin

Images & Validation

• Application Notes:
  E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Key Properties

• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Tag: N-terminal 6xHis-SUMO-tagged
• Expression Region: 2-463aa
• Protein Length: Full Length of Mature Protein
• MW: 67 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: ATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTS

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

48KDA TATA box-binding protein-interacting protein Short name, 48KDA TBP-interacting protein 51KDA erythrocyte cytosolic protein Short name, ECP-51 INO80 complex subunit J Repressing pontin 52 Short name, Reptin 52 TIP49b TIP60-associated protein 54-beta Short name, TAP54-beta

Quick Database Links

UniProt

Q9Y230