You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 30-391aa |
| Protein Length | Partial |
| MW | 44.6 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPAC |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human Receptor Tyrosine Kinase Like Orphan Receptor 1 (ROR1) ELISA Kit [orb778708]
Human
0.16-10 ng/mL
0.057 ng/mL
48 T, 96 THuman 4-1BB/TNFRSF9/CD137 & PD-L1 & ROR1 & CD3 epsilon Reference Antibody (Nebratamig, RUO) [orb2976419]
ELISA, FA, FACS, In vivo, WB
Human
Human
Monoclonal
Unconjugated
100 μg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg, 1 mgRecombinant Mouse ROR1 Protein [orb2992852]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE. (QC verified)
Predicted: 58.9 KDa. Observed: 80-120 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human ROR1 Protein [orb2992858]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE. (QC verified)
Predicted: 10.8 KDa. Observed: 16-23 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human ROR1 (Ig-like domain) Protein [orb2992882]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE. (QC verified)
Predicted: 13.4 KDa. Observed: 23-32 KDa, reducing conditions
1 mg, 10 μg, 50 μg, 500 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.






