You have no items in your shopping cart.
Featured
Description
Research Area
Musculoskeletal & Connective Tissue Research
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 29-146aa |
| Protein Length | Full Length of Mature Protein |
| MW | 17.5 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−PIP
Similar Products
−Human Prolactin Induced Protein (PIP) ELISA Kit [orb780130]
Human
0.63-40 ng/mL
0.261 ng/mL
96 T, 48 THuman PIP protein [orb418911]
Greater than 90% as determined by SDS-PAGE.
16 kDa
Yeast
100 μg, 20 μg, 1 mgPIP Mouse Monoclonal Antibody [orb705588]
IHC
Human
Mouse
Monoclonal
Unconjugated
100 μl, 30 μl, 200 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide












