You have no items in your shopping cart.
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia Coli |
|---|---|
| Purity | Greater than 98.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Protein Sequence | VHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE |
Storage & Handling
−| Storage | Stability: Lyophilized OTOR Recombinant although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution OTOR should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Buffer/Preservatives | The OTOR protein was lyophilized from a concentrated (1mg/ml) solution containing 20mM PBS pH-7.4 and 130mM NaCl. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Otoraplin, Fibrocyte-derived protein, Melanoma inhibitory activity-like protein, OTOR, MIAL, FDP, MIAL1, MGC126737, MGC126739.
Similar Products
−RecombinantOTOR,Human [orb1494671]
> 95% as analyzed by SDS-PAGE.
14-15 kDa, observed by reducing SDS-PAGE.
CHO
1 mg, 10 μg, 50 μgRecombinant Human Melanoma Inhibitor Activity Protein 2 (rHuMIA-2) [orb1494951]
>97% by SDS-PAGE and HPLC analyses.
11.5 kDa, a single non-glycosylated polypeptide chain containing 101 amino acids.
Escherichia coli
5 μg, 20 μg, 1 mgRecombinantOTOR,Human [orb1494780]
> 95% by SDS-PAGE analysis.
12.7 kDa, observed by reducing SDS-PAGE.
Escherichia coli.
10 μg, 1 mg, 50 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide

