You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 891-1048aa |
| Protein Length | Partial |
| MW | 19.7 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | DLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant Human Integrin alpha V beta 8 Heterodimer Protein [orb2993031]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 111.3&75.4 KDa. Observed: 125-160&80-100 KDa, reducing conditions
50 μg, 500 μg, 1 mg, 10 μgIntegrin AVB6 (ITGAV & ITGB6) Human Monoclonal Antibody [orb2976112]
ELISA, FA, FACS, In vivo
Human
Human
Monoclonal
Unconjugated
100 μg, 1 mgRecombinant human Integrin Alpha V Beta 3 (ITGAV & ITGB3) protein, C-His-Avi (HEK293) [orb1516400]
>95% as determined by Tris-Bis PAGE; >95% as determined by SEC-HPLC
Due to glycosylation,the protein migrates to 85-140 kDa based on Tris-Bis PAGE result.
50 μgCD51/ITGAV/ITGB6 Rat Monoclonal Antibody [orb2974852]
ELISA, FC
Human, Mouse
Rat
Monoclonal
Unconjugated
50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.










