You have no items in your shopping cart.
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Baculovirus |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human IL17A at 2 μg/ml can bind Anti-IL17A recombinant antibody, the EC50 is 1.818-2.170 ng/mL. |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 24-155aa(T26A) |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 15.9 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | GIAIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−(IL-17)(IL-17A)(Cytotoxic T-lymphocyte-associated antigen 8)(CTLA-8)
Similar Products
−Human Interleukin 17 (IL-17A) High Sensitivity ELISA Kit [orb1945901]
Human
1.56-100pg/mL
0.09 pg/mL
48 T, 96 THuman Interleukin 17A (IL-17A) Microsample Fast ELISA Kit [orb1806731]
Human
7.81-500pg/mL
5.55 pg/mL
48 T, 96 THuman IL17A protein [orb594787]
Greater than 95% as determined by SDS-PAGE.
15.26 kDa
E.coli
50 μg, 10 μg, 1 mg, 500 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide






