You have no items in your shopping cart.
Featured
Description
Research Area
Cardiovascular Research
Images & Validation
−
Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 1-75aa |
| Protein Length | Partial |
| MW | 10.8 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAGYIIVFVVALIGNVLV |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Hypocretin receptor type 2
Similar Products
−- Item 1 of 2
- Item 1 of 1
Human CD200R1 Protein, His Tag [orb1291094]
Unconjugated
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 25.0 kDa after removal of the signal peptide. The apparent molecular mass of CD200R1-His is approximately 35-70 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μg 
Human HCRTR2 Recombinant Protein (N-His-KSI) [orb3233302]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
50 μg, 100 μg, 1 mg- Item 1 of 1
Human HCRTR2 Protein, hFc Tag [orb3123943]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 32.3 kDa after removal of the signal peptide.
10 μg, 50 μg, 100 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-6 weeks