Human Growth Hormone (1-43)

SKU: orb2693997

Description

Human Growth Hormone (1-43) is an N-terminal fragment of human growth hormone with specific and pronounced insulin-like activity. Human Growth Hormone (1-43) can be used to study the function and metabolic pathways of growth hormone, a potential obesity-related factor.

Research Area

Metabolism Research

Images & Validation

−

Key Properties

−

Target	others
CAS Number	96827-07-5
MW	5215.97
Purity	≥95%
Formula	C₂₄₀H₃₅₈N₆₂O₆₇S
Protein Sequence	FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYS

Storage & Handling

−

Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

Gene Symbol

others

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide

Find More Protocols