You have no items in your shopping cart.
Featured
Description
Research Area
Immunology & Inflammation
Images & Validation
−
Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 39-193 |
| Protein Length | Extracellular Domain |
| MW | 19.1 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−CD70
Similar Products
−
Recombinant Human CD27L Protein [orb2994561]
Unconjugated
SDS-PAGE: Greater than 90% as determined by reducing SDS-PAGE.
Predicted: 43.6 KDa. Observed: 52 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human CD27L Protein [orb2992795]
Unconjugated
SDS-PAGE: Greater than 90% as determined by reducing SDS-PAGE. (QC verified)
Predicted: 21.5 KDa. Observed: 24-36 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human CD27L Protein [orb2993932]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 43 KDa. Observed: 50-60 KDa, reducing conditions
500 μg, 1 mg, 10 μg, 50 μg- Item 1 of 3
Human CD70 Protein, mFc-His Tag [orb689401]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 45.6 kDa after removal of the signal peptide.
Mammalian
10 μg, 100 μg, 50 μg - Item 1 of 2
Human CD27 Ligand/TNFSF7/CD70 Recombinant Protein (C-Fc) [orb2968812]
ELISA, SDS-PAGE, WB
>95% as determined by SDS-PAGE.
47.84 kDa
1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-6 weeks