You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 26-180aa |
| Protein Length | Extracellular Domain |
| MW | 18.4 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant Human CD7 Protein [orb2994758]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 43.4 KDa. Observed: 59 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human CD7 Protein [orb2995024]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 17.47 KDa. Observed: 32 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human CD7 Protein (Biotin) [orb2993749]
Biotin
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 19.3 KDa. Observed: 30-35 KDa, reducing conditions
20 μg, 100 μgCynomolgus CD7 Protein, hFc Tag [orb1826719]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 42.2 kDa after removal of the signal peptide. The apparent molecular mass of cCD7-hFc is approximately 55-70 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.





