human ATP6AP2 protein

SKU: orb54627

Description

This human ATP6AP2 protein spans the amino acid sequence from region 17-350aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Cell Biology

Images & Validation

• Application Notes:
  N-terminal 6xHis-tagged: N-terminal 10xHis-tagged1-89AA: 17-350AAFull Length: Full length of mature protein

Key Properties

• Source: Yeast
• Biological Origin: Homo sapiens (Human)
• Tag: N-terminal 10xHis-tagged
• Expression Region: 17-350aa
• Protein Length: Full Length of Mature Protein
• MW: 40 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

ATPase H(+)-transporting lysosomal accessory protein 2 ATPase H(+)-transporting lysosomal-interacting protein 2 ER-localized type I transmembrane adaptor Embryonic liver differentiation factor 10 N14F Renin/prorenin receptor Vacuolar ATP synthase membrane sector-associated protein M8-9

Quick Database Links

UniProt

O75787