You have no items in your shopping cart.
Featured
Description
Research Area
Cardiovascular Research
Images & Validation
−
Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal GST-tagged |
| Expression Region | 1-276aa |
| Protein Length | Full Length of Isoform 2 |
| MW | 57.7 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | MAWWKAWIEQEGVTVKSSSHFNPDPDAETLYKAMKGIGVGSQLLSHQAAAFAFPSSALTSVSPWGQQGHLCCNPAGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGSRDDVSSFVDPALALQDAQDLYAAGEKIRGTDEMKFITILCTRSATHLLRVKCTQNLHSYFAERLYYAMKGAGTRDGTLIRNIVSRSEIDLNLIKCHFKKMYGKTLSSMIMEDTSGDYKNALLSLVGSDP |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−ANXA8L1, ANXA8L2Annexin A8-like protein 1
Similar Products
−- Item 1 of 3
- Item 1 of 1
ANXA8L1/ANXA8L2 Antibody (N-term) [orb165737]
WB
Rabbit, Rat
Human
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl 
Human ANXA8L1 Protein, His Tag/His-IF2DI Tag [orb755358]
ELISA, WB
Greater than 95% as determined by SDS-PAGE
35.9 kDa
E.Coli
50 μg, 100 μg, 200 μg, 1 mgHuman Annexin A8-like 2 (ANXA8L2) Recombinant Protein [orb1647629]
Greater than 90% as determined by SDS-PAGE.
47.5 kDa
1 mg, 100 μg, 20 μgHuman Annexin A8-like 2 (ANXA8L2) Recombinant Protein [orb1647630]
Greater than 90% as determined by SDS-PAGE.
57.7 kDa
1 mg, 100 μg, 20 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 4-5 weeks