HSP90AA1 Rabbit Polyclonal Antibody

SKU: orb573596

Description

HSP90AA1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of HSP90AA1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human HSP90AA1. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Equine, Guinea pig, Rabbit, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Epigenetics & Chromatin

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Equine, Guinea pig, Rabbit, Rat, Sheep

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HSP90AA1
• Target: HSP90AA1
• Protein Sequence: Synthetic peptide located within the following region: HLYKDLQPFILLRLLMPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIIN
• Molecular Weight: 98kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

EL52, HSPN, LAP2, HSP86, HSPC1, HSPCA, Hsp89, Hsp90, LAP-2, HSP89A, HSP90A, HSP90N, Hsp103, HSPCAL1, HSPCAL4, HEL-S-65p

Quick Database Links

Gene Symbol

HSP90AA1

UniProt

P07900

RefSeq (Protein):NP_001017963