Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

HIV Type-O gp41 13kDa Protein

SKU: orb426154

Description

Recombinant of HIV Type-O gp41 13kDa protein

Research Area

Infectious Disease & Virology

Images & Validation

Application Notes
Viral Antigens- Human Immunodeficiency Virus

Key Properties

SourceEscherichia Coli
PurityGreater than 95.0% as determined by SDS-PAGE.
Protein SequenceMGHHHHHHGSVQTHTLLKGIVQQQDNLLRAIQAQQHLLRLSVWGIRQLRARLLALETLI QNQQLLNLWGAKGRLIAYTSVKWNTTWGGGGSIWGNLTWQEWDQQIDNVSSIIYEEIQ KAQDQQEQNEKKLLELDE

Storage & Handling

StorageStability: HIV Type-O gp41 although stable at room temperature for 4 weeks, should be stored below -18°C. Please prevent freeze thaw cycles
Form/AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
Buffer/PreservativesLyophilized from 1mg/ml in 20mM Na-carbonate, pH 9.6.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

100 μg
$ 330.00
0.5 mg
$ 680.00
1 mg
$ 930.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry