Glucagon-Like Peptide I (7-36), amide, human

SKU: orb2694622

Description

Human glucagon-like peptide I amide fragment 7-36 was used in DMEM (Dulbeccos) medium to culture 3T3-L1 adipocytes to study the relationship between adipose tissue GLP-1 receptors and obesity and insulin resistance. GLP-1 (glucagon-like peptide 1) (7-36) amide is a potent insulinotropic peptide that initiates glucose-induced insulin release after a meal or oral glucose. It has antidiabetic effects, so it may be used to treat non-insulin-dependent diabetes.

Research Area

Pharmacology & Drug Discovery

Key Properties

• Target: GCCR
• CAS Number: 107444-51-9
• MW: 3297.7
• Purity: ≥95%
• Formula: C₁₄₉H₂₂₆N₄₀O₄₅
• Protein Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

Storage & Handling

• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Quick Database Links

Gene Symbol

GCCR