You have no items in your shopping cart.
Description
Research Area
Metabolism Research
Images & Validation
−
Key Properties
−| CAS Number | 725474-97-5 |
|---|---|
| MW | 4633.2 Da |
| Purity | > 95% By HPLC |
| Formula | C210H316N56O61S |
| Protein Sequence | H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-OH |
Storage & Handling
−| Storage | Store dark, dry and frozen |
|---|---|
| Form/Appearance | Freeze dried solid |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−endogenous, food intake, 725474-97-5GH160, GIP (1-39), Gastric Inhibitory Polypeptide, Glucose-dependent Insulinotropic Polypeptide, YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHN, diabetes, insulinotropic
Similar Products
−Neochlorogenic acid methyl ester [orb1297054]
99.91% (May vary between batches)
123410-65-1
368.34
C17H20O9
2 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg, 1 ml x 10 mM (in DMSO), 1 mgGIP (1-39) acetate [orb1296394]
98.93% (May vary between batches)
4693.21
1 mg, 5 mg, 10 mg, 25 mg, 50 mg, 100 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
