GHRF (1-44), human

SKU: orb2694934

Description

Growth Hormone Releasing FactorGHRF (1-44), human Overview Properties Growth hormone-releasing factor (GHRF) is a hypothalamic peptide which positively regulates the synthesis and secretion of growth hormone in the anterior pituitary. The amino-acid sequence of a 43-residue GHRF peptide isolated from rat hypothalamus was recently determined.

Images & Validation

−

Key Properties

−

Target	GnRH Receptor
CAS Number	83930-13-6
MW	5039.7
Purity	≥95%
Formula	C₂₁₅H₃₅₈N₇₂O₆₆S
Protein Sequence	YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2

Storage & Handling

−

Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

Gene Symbol

GnRH Receptor

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide

Find More Protocols

Purity:	> 95%
MW:	5039.7
Source:	Synthetic

GHRF (1-44), human

Description

Images & Validation

Key Properties

Storage & Handling

Similar Products

GHRF (1-44) Human peptide [orb216613]

Human GHRF (1-44) peptide [orb71621]

Quality Guarantee

Quick Database Links

Protocol Information

Available Sizes

Email

UK Office

US Office

CN Office

Distributors