DDIT3 Rabbit Polyclonal Antibody

SKU: orb573857

Description

DDIT3 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of DDIT3. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N-terminal region of Human DDIT3. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Sheep

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human DDIT3
• Target: DDIT3
• Protein Sequence: Synthetic peptide located within the following region: SLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTT
• Molecular Weight: 21kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CHOP, CEBPZ, CHOP10, CHOP-10, GADD153, AltDDIT3, C/EBPzeta

Quick Database Links

Gene Symbol

DDIT3

UniProt

F8VS99

RefSeq (Protein):NP_001181985