Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Cecropin A

SKU: orb1147115

Description

Broad spectrum insect antimicrobial; Antibacterial; Antifungal; Antimicrobial peptides.

Research Area

Microbiology

Images & Validation

−

Key Properties

−
CAS Number80451-04-3
MW4003.8 Da
Purity> 95% by HPLC
FormulaC184H313N53O46
Protein SequenceH-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2

Storage & Handling

−
StorageStore desiccated, frozen and in the dark
Form/AppearanceFreeze dried solid
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

−
80451-04-3AM080 , AMP, CeA, CeA), Cecropin A, H-KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2, Hyalophora cecropia, KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2, antimicrobial peptide, moths

Similar Products

−
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

1 mg
$ 410.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry