CASP1 Rabbit Polyclonal Antibody

SKU: orb333727

Description

CASP1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of CASP1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human CASP1. This antibody reacts with Human samples and is predicted to react with Equine, Rabbit, Yeast. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Equine, Rabbit, Yeast

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CASP1
• Target: CASP1
• Protein Sequence: Synthetic peptide located within the following region: LQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEE
• Molecular Weight: 10kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti CASP-1 antibody, anti CASP1 antibody, anti Caspase 1 antibody, anti Caspase-1 subunit p10 antibody, anti ICE antibody, anti IL-1 beta-converting enzyme antibody, anti IL-1BC antibody, anti IL1 beta converting enzyme antibody, anti IL1B convertase antibody, anti Interleukin 1 beta convertase antibody, anti Interleukin 1B converting enzyme antibody, anti Interleukin-1 beta convertase antibody, anti Interleukin-1 beta-converting enzyme antibody, anti p45 antibody

Quick Database Links

Gene Symbol

CASP1

UniProt

P29466

RefSeq (Protein):NP_001214