Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

CASP1 Rabbit Polyclonal Antibody

SKU: orb333727

Description

CASP1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of CASP1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human CASP1. This antibody reacts with Human samples and is predicted to react with Equine, Rabbit, Yeast. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

−
Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityEquine, Rabbit, Yeast

Related Conjugates & Formulations

−

Key Properties

−
HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CASP1
TargetCASP1
Protein SequenceSynthetic peptide located within the following region: LQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEE
Molecular Weight10kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

−
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

−
anti CASP-1 antibody, anti CASP1 antibody, anti Caspase 1 antibody, anti Caspase-1 subunit p10 antibody, anti ICE antibody, anti IL-1 beta-converting enzyme antibody, anti IL-1BC antibody, anti IL1 beta converting enzyme antibody, anti IL1B convertase antibody, anti Interleukin 1 beta convertase antibody, anti Interleukin 1B converting enzyme antibody, anti Interleukin-1 beta convertase antibody, anti Interleukin-1 beta-converting enzyme antibody, anti p45 antibody

Similar Products

−
  • Caspase-1 P10 Rabbit Polyclonal Antibody [orb10232]

    FC,  IF,  IHC-Fr,  IHC-P

    Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Caspase-1 p20 Rabbit Polyclonal Antibody [orb317579]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Human, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Caspase-1 p20 Rabbit Polyclonal Antibody [orb221355]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Cleaved-Caspase-1 p20 (D210) rabbit pAb Antibody [orb770550]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl
  • Caspase-1 p20 Rabbit Polyclonal Antibody (FITC) [orb318090]

    FC,  IF

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    FITC

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

UniProt Details

−
No UniProt data available

NCBI Reference Sequences

−
Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001214

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry