C-Type Natriuretic Peptide (1-53) (human)

SKU: orb2693717

Description

C-Type Natriuretic Peptide (1-53), human is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone.

Research Area

Cardiovascular Research

Images & Validation

−

Key Properties

−

Target	Angiotensin Receptor
CAS Number	141294-77-1
MW	5801.81
Purity	≥95%
Formula	C₂₅₁H₄₁₇N₈₁O₇₁S₃
Protein Sequence	DLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge:Cys37-Cys55)

Storage & Handling

−

Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

Angiotensin Receptor

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide