Big Endothelin-1 (1-38), human

SKU: orb2694119

This product can be custom made

Description

Big Endothelin-1 (1-38), human is the precursor of endothelin-1. Endothelin-1 (ET-1) is a potent vasopressor peptide.

Research Area

Epigenetics & Chromatin

Images & Validation

−

Key Properties

−

Target	Vasopressin Receptor
CAS Number	120796-97-6
MW	4282.96
Purity	≥95%
Formula	C₁₈₉H₂₈₂N₄₈O₅₆S₅
Protein Sequence	CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS (Disulfide bridge: Cys1-Cys15; Cys3-Cys11)

Storage & Handling

−

Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Quick Database Links

Gene Symbol

Vasopressin Receptor

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide

Find More Protocols

Purity:	≥95%
CAS Number:	124363-98-0
MW:	4282.96
Formula:	C₁₈₉H₂₈₂N₄₈O₅₆S₅

Purity:	> 95%
MW:	4282.96
Source:	Synthetic