Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Bay 55-9837

SKU: orb1140495

Description

Selective VPAC2 agonist; Peptides.

Images & Validation

Key Properties

CAS Number463930-25-8
MW3742.29 Da
Purity> 95% by hplc
FormulaC167H270N52O46
Protein SequenceH-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Val-Ala-Ala-Lys-Lys-Tyr-Leu-Gln-Ser-Ile-Lys-Asn-Lys-Arg-Tyr-NH2

Storage & Handling

StorageStore dry, frozen and in the dark
Form/AppearanceFreeze dried solid
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

463930-25-8, Bay 55-9837, HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY-NH2,

Similar Products

  • Bay 55-9837 acetate [orb1296377]

    98.27% (May vary between batches)

    3802.30

    1 mg, 5 mg, 10 mg, 25 mg, 50 mg
  • Bay 55-9837 TFA [orb1981627]

    3456.22

    50 mg, 5 mg
  • Bay 55-9837 [orb1679282]

    3742.29

    1 mg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

1 mg
$ 390.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry