AVS Bio - Recombinant human Mart1

SKU: M002

Description

The expression of Mart1 is restricted to the retina, melanomas and melanocyte cell lines. It is involved in melanosome biogenesis by ensuring the stability of GPR143 and plays a vital role in the expression, stability, trafficking, and processing of melanocyte protein PMEL, which is critical to the formation of stage II melanosomes. Intracellular it is found in small vesicles and tubules dispersed over the entire cytoplasm. A small fraction of the protein is inserted into the membrane in an inverted orientation. Inversion of membrane topology results in the relocalization of the protein from a predominant Golgi/post-Golgi area to the endoplasmic reticulum. Melanoma cells expressing the protein with an inverted membrane topology are more effectively recognized by specific cytolytic T-lymphocytes than those expressing the protein in its native membrane orientation. Residues 1-118 of human Mart1 were cloned, the protein was over-expressed in HEK293 and was purified to homogeneity. The calculated molecular weight of recombinant Mart1 is 18.6 kDa (including purification tag). The protein contains a C-terminal (TEV-Strep)-tag. Each vial contains 100 µg Mart1 at a concentration of 0.44 mg/ml.

Research Area

Cancer Biology

Key Properties

• Protein Sequence: mpredahfiygypkkghghsyttaeelagigiltvilgvllligcwycrrrngyralmdkslhvgtqcaltrrcpqegfdhrdskvslqekncepvvpnappayeklsae qspppyspaaaenlyfqgaawshpqfekgaawshpqfekgaawshpqfekgaa*

Storage & Handling

• Storage: Mart1 should be stored at - 80°C (stable for at least 1 year). The buffer contains 20 HEPES,150 mM NaCl, 0.05% DDM, 1 mM DTT, pH 7.4 without preservative. After thawing it should be stored in appropriate small aliquots at - 20°C or - 80°C (stable for at least 2 months).
• Form/Appearance: solution
• Expiration Date: For shelf life and expiration details, please refer to the Certificate of Analysis (CoA).
• Dry Ice Shipping: Please note: This product requires shipment on dry ice. A dry ice surcharge will apply.
• Disclaimer: For research use only

Alternative Names

melanoma antigen recognized by T-cells 1; Mart1; MLANA; Melan A;

Quick Database Links

UniProt

Q16655