AVS Bio - Recombinant mannose-binding protein C

SKU: M001

Description

Mannose-binding protein C belongs to the collectin family and is an important element in the innate immune system. The protein recognizes mannose and N-acetylglucosamine on many microorganisms, and is capable of activating the classical complement pathway. Deficiencies of mannose-binding protein C have been associated with susceptibility to autoimmune and infectious diseases. Residues 21-248 of human mannose-binding protein C were cloned, the protein was over-expressed in HEK293 EBNA1 cells and purified to homogeneity (figure 1). The calculated molecular weight of recombinant human mannose-binding protein C, residues 21-248, is 27.0 kDa. It contains an N-terminal hexahistidine tag and a TEV cleavage site. Each vial contains 100 µg MBP-c at 0.175 mg/ml.

Key Properties

• Protein Sequence: marplctllllmatlagalagshhhhhhdydipssenlyfqgsetvtcedaqktcpaviacsspgingfpgkdgrdgtkgekgepgqglrglqgppgklgppgnpgpsgspgpkgqkgdpgkspdgdsslaaserkalqtemarikkwltfsl

Storage & Handling

• Storage: MBP-c should be stored at - 80°C (stable for at least 1 year). The buffer contains PBS without preservative. After thawing it should be stored in appropriate small aliquots at - 20°C or - 80°C (stable for at least 2 months).
• Form/Appearance: solution
• Expiration Date: For shelf life and expiration details, please refer to the Certificate of Analysis (CoA).
• Dry Ice Shipping: Please note: This product requires shipment on dry ice. A dry ice surcharge will apply.
• Disclaimer: For research use only

Alternative Names

MBP-c; mannose-binding lectin (protein C) 2; Collectin-1; MBP1; soluble MBL2; Mannan-binding protein; Mannose-binding lectin

Quick Database Links

UniProt

P11226