AVS Bio - Recombinant human CD36-ECD

SKU: C007

Description

Residues 30-439 of human CD36 were cloned, the protein was over-expressed in HEK293EBNA1 cells and was purified to homogeneity (figure 1). The calculated molecular weight of monomeric recombinant human CD36-ECD is 52.4 kDa (including purification tag). The protein contains a N-terminal (Strep - TEV) tag. Each vial contains 100 µg CD36-ECD at a concentration of 0.28 mg/ml.

Research Area

Cancer Biology

Key Properties

• Protein Sequence: mrpwtwvllllllicapsyagswshpqfekgswshpqfekgswshpqfekgsdydipssenlyfqgsgdlliqktikkqvvleegtiafknwvktgtevyrqfwifdvq npqevmmnssniqvkqrgpytyrvrflakenvtqdaedntvsflqpngaifepslsvgteadnftvlnlavaaashiyqnqfvqmilnslinkskssmfqvrtlrellw gyrdpflslvpypvtttvglfypynntadgvykvfngkdniskvaiidtykgkrnlsyweshcdmingtdaasfppfveksqvlqffssdicrsiyavfesdvnlkgipvyr fvlpskafaspvenpdnycfctekiisknctsygvldiskckegrpvyislphflyaspdvsepidglnpneeehrtyldiepitgftlqfakrlqvnllvkpsekiqvlknlkr nyivpilwlnetgtigdekanmfrsqvtgkinaaa*

Storage & Handling

• Storage: CD36-ECD should be stored at - 80°C (stable for at least 1 year). The buffer contains PBS without preservative. After thawing it should be stored in appropriate small aliquots at - 20°C or - 80°C (stable for at least 2 months).
• Form/Appearance: solution
• Expiration Date: For shelf life and expiration details, please refer to the Certificate of Analysis (CoA).
• Dry Ice Shipping: Please note: This product requires shipment on dry ice. A dry ice surcharge will apply.
• Disclaimer: For research use only

Alternative Names

platelet glycoprotein 4; cluster determinant 36; fatty acid translocase; scavenger receptor class B, member 3; CD36 antigen (collagen type I receptor, thrombospondin receptor); glycoprotein IIIb; platelet glycoprotein IV; leukocyte differentiation antigen CD36; PAS-4 protein; GPIIIB; PAS IV; SCARB3;

Quick Database Links

UniProt

P16671