AVS Bio - Recombinant β2-Glycoprotein I, human

SKU: G007

Description

β2-Glycoprotein I has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, and the production of antiphospholipid autoantibodies. β2-Glycoprotein I may be a required cofactor for anionic phospholipid binding by the antiphospholipid autoantibodies found in sera of many patients with lupus and primary antiphospholipid syndrome, but it does not seem to be required for the reactivity of antiphospholipid autoantibodies associated with infections. Residues 20-345 of human β2-Glycoprotein I were cloned, the protein was over-expressed in HEK293EBNA1 cells and purified to homogeneity. The protein is identical to product G002, of which the N-terminal TEV-protease cleavable hexahistidine tag has been removed. The calculated molecular weight of recombinant human β2-Glycoprotein I, residues 20-345, is 36.4 kDa. Each vial contains 100 µg β2-Glycoprotein I at 0.5 mg/ml.

Research Area

Hematology

Key Properties

• Protein Sequence: sgrtcpkpddlpfstvvplktfyepgeeitysckpgyvsrggmrkficpltglwpintlkctprvcpfagilengavryttfeypntisfscntgfylngadsakcteegkw spelpvcapiicpppsiptfatlrvykpsagnnslyrdtavfeclpqhamfgndtitctthgnwtklpecrevkcpfpsrpdngfvnypakptlyykdkatfgchdgysl dgpeeiectklgnwsampsckascklpvkkatvvyqgervkiqekfkngmlhgdkvsffcknkekkcsytedaqcidgtievpkcfkehsslaf wktdasdvkpc*

Storage & Handling

• Storage: β2-GPI should be stored at - 80°C (stable for at least 1 year). The buffer contains 20 mM Tris 150 mM NaCl pH 7.5 without preservative. After thawing it should be stored in appropriate small aliquots at - 20°C or - 80 °C (stable for at least 2 months).
• Form/Appearance: solution
• Expiration Date: For shelf life and expiration details, please refer to the Certificate of Analysis (CoA).
• Dry Ice Shipping: Please note: This product requires shipment on dry ice. A dry ice surcharge will apply.
• Disclaimer: For research use only