ATG16L1 Rabbit Polyclonal Antibody

SKU: orb330735

Description

ATG16L1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of ATG16L1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human ATG16L1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ATG16L1
• Target: ATG16L1
• Protein Sequence: Synthetic peptide located within the following region: QYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQ
• Molecular Weight: 66kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti APG16L antibody, anti ATG16L antibody, anti FLJ00045 antibody, anti FLJ10035 antibody, anti FLJ10828 antibody, anti FLJ22677 antibody, anti IBD10 antibody, anti WDR30 antibody, anti ATG16A antibody

Quick Database Links

Gene Symbol

ATG16L1

UniProt

Q676U5

RefSeq (Protein):NP_060444