You have no items in your shopping cart.
Description
Images & Validation
−
Key Properties
−| Purification | HPLC |
|---|---|
| Protein Sequence | KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2, disulfide bonds:C2=C7 |
Storage & Handling
−| Storage | Shipped at 4°C. Stored at -20°C for one year. Avoid repeated freeze/thaw cycles. |
|---|---|
| Form/Appearance | Lyophilized |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Islet amyloid polypeptide; IAPP; Amylin 1-37;Amylin(1-37);
Similar Products
−Amylin (1-37), human acetate [orb2944179]
99.53% (May vary between batches)
10 mg, 5 mg, 25 mg, 1 mg, 50 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide