You have no items in your shopping cart.
Aldosterone Secretion Inhibiting Factor (1-35) (bovine)
SKU: orb2692926
Description
Research Area
Pharmacology & Drug Discovery
Images & Validation
−
Key Properties
−| MW | 3910.64 |
|---|---|
| Purity | ≥95% |
| Formula | C164H278N58O45S4 |
| Protein Sequence | ALRGPKMMRNDSGCFGRRLDRIGSLSGLGCNVLRRY(Disulfide bridge:Cys13-Cys29) |
Storage & Handling
−| Expiration Date | 6 months from date of receipt. |
|---|---|
| Disclaimer | For research use only |
Similar Products
−
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide