Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

AGT Rabbit Polyclonal Antibody

SKU: orb333716

Description

AGT Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of AGT. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human AGT. This antibody reacts with Human samples and is predicted to react with Canine, Equine, Mouse, Rabbit, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin, Neuroscience, Pharmacology & Drug Discovery, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

−
Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityCanine, Equine, Mouse, Rabbit, Rat, Sheep

Related Conjugates & Formulations

−

Key Properties

−
HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human AGT
TargetAGT
Protein SequenceSynthetic peptide located within the following region: IHPFHLVIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQ
Molecular Weight53kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

−
StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

−
Anti-Aangiotensinogen (serpin peptidase inhibitor clade A member 8) antibody, anti-AGT antibody, anti-AI265500 antibody, anti-Alpha 1 antiproteinase antitrypsin antibody, anti-Ang antibody, anti-Ang I antibody, anti-Ang II antibody, anti-Ang III antibody, anti-AngII antibody, anti-Angiotensin I antibody, anti-Angiotensin II antibody, anti-Angiotensin III antibody, anti-Angiotensin-3 antibody, anti-Angiotensinogen (PAT) antibody, anti-Angiotensinogen antibody, anti-ANGT_HUMAN antibody, anti-ANHU antibody, anti-ANRT antibody, anti-AT-2 antibody, anti-AT-II antibody, anti-Des-Asp[1]-angiotensin II antibody, anti-FLJ92595 antibody, anti-FLJ97926 antibody, anti-MGC105326 antibody, anti-PAT antibody, anti-Pre angiotensinogen antibody, anti-Serine (or cysteine) proteinase inhibitor antibody, anti-Serpin A8 antibody, anti-Serpin peptidase inhibitor clade A member 8 antibody, anti-SERPINA8 antibody

Similar Products

−
  • AGXT Antibody (Center) [orb1930043]

    FC,  IHC-P,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • Angiotensin II Rabbit Polyclonal Antibody [orb312147]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Human, Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Angiotensinogen Rabbit Polyclonal Antibody [orb396147]

    ELISA,  IHC-P,  WB

    Canine, Equine, Human, Mouse, Porcine, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 500 μg
  • Angiotensinogen Rabbit Polyclonal Antibody [orb500967]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Angiotensinogen Rabbit Polyclonal Antibody [orb556118]

    ICC,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

UniProt Details

−
No UniProt data available

NCBI Reference Sequences

−
Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000020

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry