You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Mouse, Porcine, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human PRODH2 |
| Target | PRODH2 |
| Protein Sequence | Synthetic peptide located within the following region: LGIPLDGTVCFGQLLGMCDHVSLALGQAGYVVYKSIPYGSLEEVIPYLIR |
| Molecular Weight | 59kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−PRODH Rabbit Polyclonal Antibody [orb100680]
IF, IHC-Fr, IHC-P, WB
Equine, Human, Rat
Mouse
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlPRODH polyclonal antibody [orb641777]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 200 μl, 50 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

WB analysis of orb324958.

Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/mL.

Rabbit Anti-PRODH2 Antibody, Paraffin Embedded Tissue: Human Intestine, Cellular Data: Epithelial cells of intestinal villas, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-PRODH2 Antibody Titration: 0.2-1 ug/mL, Positive Control: HepG2 cell lysate, PRODH2 is supported by BioGPS gene expression data to be expressed in HepG2.
Documents Download
Request a Document
Protocol Information
PRODH2 Rabbit Polyclonal Antibody (orb324958)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review


