PRKCH Rabbit Polyclonal Antibody

SKU: orb583273

Description

Rabbit polyclonal antibody to PRKCH

Research Area

Cell Biology, Epigenetics & Chromatin, Protein Biochemistry, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRKCH
• Target: PRKCH
• Protein Sequence: Synthetic peptide located within the following region: KKGHQLLDPYLTVSVDQVRVGQTSTKQKTNKPTYNEEFCANVTDGGHLEL
• Molecular Weight: 78 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

PKCL, PKC-L, PRKCL, nPKC-eta

Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.

25 ug of HepG2 and whole cell extract was loaded onto a 12% SDS-PAGE gel. Blot was incubated with 3 ug/ml of antibody.

Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.

WB Suggested Anti-PRKCH Antibody, Titration: 1.0 ug/ml, Positive Control: Jurkat Whole Cell. PRKCH is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

Quick Database Links

Gene Symbol

PRKCH

UniProt

P24723

RefSeq (Protein):NP_006246