PRKAR2A Rabbit Polyclonal Antibody

SKU: orb585055

Description

Rabbit polyclonal antibody to PRKAR2A

Research Area

Cell Biology, Protein Biochemistry, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PRKAR2A
• Target: PRKAR2A
• Protein Sequence: Synthetic peptide located within the following region: IESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAAS
• Molecular Weight: 44 kDa
• Purification: Affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

PKR2, PRKAR2

Sample Tissue: Human PC-3 Whole cell lysates, Antibody dilution: 1 ug/ml.

Quick Database Links

Gene Symbol

PRKAR2A

UniProt

P13861

RefSeq (Protein):NP_004148