PRKACB Rabbit Polyclonal Antibody

• Catalog Number: orb583150
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PRKACB
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Sheep, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRKACB
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 41 kDa
• Target: PRKACB
• UniProt ID: P22694
• Protein Sequence: Synthetic peptide located within the following region: NGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDI
• NCBI: NP_002722
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CAFD2, PKACB, PKA C-beta
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.2 ug/ml of the antibody was used in this experiment.

Sample Tissue: Mouse Heart, Antibody dilution: 1 ug/ml.

Positive control (+): Rat brain (R-BR), Negative control (-): Rat liver (R-LI), Antibody concentration: 2 ug/ml.

WB Suggested Anti-PRKACB Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Lung.