PRF1 monoclonal antibody (M04), clone 3B4

• Catalog Number: orb2292353
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant PRF1.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: PRF1 (NP_005032.2, 461 a.a. ~ 555 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: WSVRLDFGDVLLATGGPLRLQVWDQDSGRDDDLLGTCDQAPKSGSHEVRCNLNHGHLKFRYHARCLPHLGGGTCLDYVPQMLLGEPPGNRSGAVW
• Tested applications: ELISA, IP, WB
• Clone Number: 3B4
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_005032.2

Detection limit for recombinant GST tagged PRF1 is 0.1 ng/ml as a capture antibody.

Immunoprecipitation of PRF1 transfected lysate using anti-PRF1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PRF1 MaxPab rabbit polyclonal antibody.

Western Blot analysis of PRF1 expression in transfected 293T cell line by PRF1 monoclonal antibody (M04), clone 3B4. Lane 1: PRF1 transfected lysate (61.4 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.19 KDa).