You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
PRDM6 Rabbit Polyclonal Antibody
Catalog Number: orb575905
| Catalog Number | orb575905 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to PRDM6 |
| Target | PRDM6 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human PRDM6 |
| Protein Sequence | Synthetic peptide located within the following region: FAGATTLNNHIRTHTGEKPFKCERCERSFTQATQLSRHQRMPNECKPITE |
| UniProt ID | Q9NQX0 |
| MW | 45kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | PDA3, KMT8C, PRISM |
| Note | For research use only |
Sample Type: Jurkat Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.
Positive control (+): 293T (2T), Negative control (-): A549 (N03), Antibody concentration: 1 ug/ml.
- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
