PRAP1 Rabbit Polyclonal Antibody

• Catalog Number: orb326261
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PRAP1
• Target: PRAP1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: VLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHPQ
• UniProt ID: Q96NZ9
• MW: 17kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti MGC126792 antibody, anti PRO1195 antibody, an
• Note: For research use only
• NCBI: NP_033413
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-PRAP1 Antibody, Titration: 1.0 ug/mL, Positive Control: THP-1 Whole Cell.