PPIE Rabbit Polyclonal Antibody

SKU: orb577702

Description

Rabbit polyclonal antibody to PPIE

Research Area

Epigenetics & Chromatin, Molecular Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Sheep, Yeast

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PPIE
• Target: PPIE
• Protein Sequence: Synthetic peptide located within the following region: KKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKP
• Molecular Weight: 33kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CYP33, CYP-33

Paraffin Embedded Tissue: Human Kidney Cellular Data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.

WB Suggested Anti-PPIE Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:62500, Positive Control: K562 cell lysate. PPIE is strongly supported by BioGPS gene expression data to be expressed in Human K562 cells.

Quick Database Links

Gene Symbol

PPIE

UniProt

Q9UNP9

RefSeq (Protein):NP_006103