You have no items in your shopping cart.
Cart summary
Item 1 of 1
PPFIBP1 Rabbit Polyclonal Antibody
Catalog Number: orb578350
Product Properties
| Catalog Number | orb578350 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to PPFIBP1 |
| Target | PPFIBP1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PPFIBP1 |
| Protein Sequence | Synthetic peptide located within the following region: PFMGSLRALHLVEDLRGLLEMMETDEKEGLRCQIPDSTAETLVEWLQSQM |
| UniProt ID | Q86W92 |
| MW | 19kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | L2, SGT2, hSGT2, hSgt2p |
| Research Area | Cell Biology, Disease Biomarkers, Molecular Biolog Read more... |
| Note | For research use only |
| NCBI | NP_803193 |
Images
WB Suggested Anti-PPFIBP1 Antibody Titration: 2.5 ug/ml, Positive Control: Jurkat cell lysate.
Similar Products
- Item 1 of 3
- Item 1 of 3
PPFIBP1 Antibody [orb630119]
ELISA, IHC, IP, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μg, 50 μg - Item 1 of 1
- Item 1 of 1
- Item 1 of 1
Reviews
PPFIBP1 Rabbit Polyclonal Antibody (orb578350)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review