Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Ppargc1a Rabbit Polyclonal Antibody

SKU: orb330035

Description

Ppargc1a Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Ppargc1a. It is suitable for WB application. The immunogen is a synthetic peptide corresponding to a region of Mouse. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
TargetPpargc1a
Protein SequenceSynthetic peptide located within the following region: LENGYTLRRSNETDFELYFCGRKQFFKSNYADLDTNSDDFDPASTKSKYD
Molecular Weight90kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti A830037N07Rik antibody, anti PGC-1 antibody, anti PGC-1v antibody, anti Pgc-1alpha antibody, anti Pgc1 antibody, anti Pgco1 antibody, anti Ppargc1 antibody, anti Gm11133 antibody, anti ENSMUSG00000079510 antibody

Similar Products

  • PGC1 alpha + beta Rabbit Polyclonal Antibody [orb100963]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Mouse, Porcine, Rabbit

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • PPARGC1A Rabbit Polyclonal Antibody [orb317701]

    ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Goat, Mouse, Porcine, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • PPARGC1A Rabbit Polyclonal Antibody [orb330034]

    WB

    Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • PPARGC1A Rabbit Polyclonal Antibody [orb1974626]

    ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Goat, Mouse, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • PGC1 alpha Rabbit Polyclonal Antibody [orb13647]

    WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Ppargc1a Rabbit Polyclonal Antibody

Lanes: Lane 1: 20 ug cytosolic fraction mesangial cells, Lane 2: 20 ug cytosolic fraction mesangial cells, Lane 3: 20 ug mitochondrial fraction mesangial cells, Lane 4: 20 ug treated cytosolic fraction mesangial cells, Lane 5: 20 ug Myometrial tissue lysate, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit HRP, Secondary Antibody Dilution: 1:10000, Gene Name: PGC1 alpha.

Ppargc1a Rabbit Polyclonal Antibody

WB Suggested Anti-Ppargc1a Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Mouse Brain.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_032930

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Ppargc1a Rabbit Polyclonal Antibody (orb330035)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry