Ppargc1a Rabbit Polyclonal Antibody

• Catalog Number: orb330035
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Ppargc1a
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 90kDa
• Target: Ppargc1a
• UniProt ID: O70343
• Protein Sequence: Synthetic peptide located within the following region: LENGYTLRRSNETDFELYFCGRKQFFKSNYADLDTNSDDFDPASTKSKYD
• NCBI: NP_032930
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti A830037N07Rik antibody, anti PGC-1 antibody,
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Lanes: Lane 1: 20 ug cytosolic fraction mesangial cells, Lane 2: 20 ug cytosolic fraction mesangial cells, Lane 3: 20 ug mitochondrial fraction mesangial cells, Lane 4: 20 ug treated cytosolic fraction mesangial cells, Lane 5: 20 ug Myometrial tissue lysate, Primary Antibody Dilution: 1:500, Secondary Antibody: Goat anti-rabbit HRP, Secondary Antibody Dilution: 1:10000, Gene Name: PGC1 alpha.

WB Suggested Anti-Ppargc1a Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Mouse Brain.