Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Ppara Rabbit Polyclonal Antibody

SKU: orb574921

Description

Ppara Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting Ppara. It is suitable for IHC, WB and is reactive with human, rat samples. Predicted reactivity includes Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Sheep, Zebrafish. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cancer Biology, Cell Biology, Epigenetics & Chromatin, Molecular Biology, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Rat
Predicted ReactivityBovine, Canine, Equine, Goat, Guinea pig, Mouse, Porcine, Rabbit, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
TargetPpara
Protein SequenceSynthetic peptide located within the following region: LHLQSNHPDDTFLFPKLLQKMVDLRQLVTEHAQLVQVIKKTESDAALHPL
Molecular Weight51kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

PPAR

Similar Products

  • PPAR alpha Rabbit Polyclonal Antibody [orb15031]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Gallus, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • PPAR alpha Rabbit Polyclonal Antibody [orb499655]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Canine, Equine, Gallus, Porcine, Rabbit, Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • PPAR-α Polyclonal Antibody [orb1412440]

    IF,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • PPARA Rabbit Polyclonal Antibody [orb574497]

    WB

    Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • Phospho-PPAR alpha (Ser12) Rabbit Polyclonal Antibody [orb6776]

    ELISA,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Guinea pig, Porcine

    Human, Mouse, Rabbit, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Ppara Rabbit Polyclonal Antibody

Rabbit Anti-Ppara Antibody, Catalog Number: orb574921, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Nuclear, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Ppara Rabbit Polyclonal Antibody

Rabbit Anti-Ppara Antibody, Catalog Number: orb574921, Formalin Fixed Paraffin Embedded Tissue: Human Adult liver, Observed Staining: Nuclear and some weak cytoplasmic, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Ppara Rabbit Polyclonal Antibody

WB Suggested Anti-Ppara antibody Titration: 1 ug/ml, Sample Type: Human heart.

Ppara Rabbit Polyclonal Antibody

WB Suggested Anti-Ppara Antibody, Titration: 1.0 ug/ml, Positive Control: Rat Brain.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_037328

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

Ppara Rabbit Polyclonal Antibody (orb574921)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry