POU3F2 Rabbit Polyclonal Antibody

• Catalog Number: orb592907
• Category: Antibodies
• Description: Rabbit polyclonal antibody to POU3F2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Porcine, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human POU3F2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 47kDa
• Target: POU3F2
• UniProt ID: P20265
• Protein Sequence: Synthetic peptide located within the following region: QLEKEVVRVWFCNRRQKEKRMTPPGGTLPGAEDVYGGSRDTPPHHGVQTP
• NCBI: NP_005595
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: BRN2, OCT7, OTF7, OTF-7, POUF3, brn-2, oct-7, N-Oc
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-POU3F2 Antibody Titration: 0.2-1 ug/ml, Positive Control: Transfected 293T.